SCAND2 Antibody - middle region : FITC

SCAND2 Antibody - middle region : FITC
Artikelnummer
AVIARP58173_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The SCAN domain is a highly conserved, leucine-rich motif of approximately 60 aa originally found within a subfamily of zinc finger proteins. Functional studies have established that the SCAN box is a protein interaction domain that mediates both hetero- and homoprotein associations, and maybe involved in regulation of transcriptional activity.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SCAND2

Key Reference: 0

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: IQQVEQLKQEVSRLARERDAYKVKCEKLANSGFREAGSTSDSPSSPEFFL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Putative SCAN domain-containing protein 2

Protein Size: 152

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58173_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58173_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54581
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×