SCCPDH Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: SCCPDH belongs to the saccharopine dehydrogenase family. The exact function of SCCPDH remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SCCPDH

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: FSFGYFSKQGPTQKQIDAASFTLTFFGQGYSQGTGTDKNKPNIKICTQVK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Saccharopine dehydrogenase-like oxidoreductase

Protein Size: 429

Purification: Affinity Purified

• Artikelnummer: AVIARP53711_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53711_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Dog (Canine), Guinea Pig, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 51097
• Wirt: Rabbit
• Konjugat: Conjugated, HRP