SCCPDH Antibody - middle region : HRP

SCCPDH Antibody - middle region : HRP
Artikelnummer
AVIARP53710_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SCCPDH belongs to the saccharopine dehydrogenase family. The exact function of SCCPDH remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SCCPDH

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: SDVSVVRRTQRYLYENLEESPVQYAAYVTVGGITSVIKLMFAGLFFLFFV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Saccharopine dehydrogenase-like oxidoreductase

Protein Size: 429

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53710_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53710_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51097
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×