SCFD1 Antibody - N-terminal region : Biotin

SCFD1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55851_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SCFD1

Key Reference: Beausoleil,S.A., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (33), 12130-12135

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: SAVTQVAKVFDQYLNFITLEDDMFVLCNQNKELVSYRAINRPDITDTEME

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Sec1 family domain containing 1, isoform CRA_b EMBL EAW65968.1

Protein Size: 575

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55851_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55851_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23256
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×