SCO1 Antibody - C-terminal region : FITC

SCO1 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP56593_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Mammalian cytochrome c oxidase (COX) catalyzes the transfer of reducing equivalents from cytochrome c to molecular oxygen and pumps protons across the inner mitochondrial membrane. In yeast, 2 related COX assembly genes, SCO1 and SCO2 (synthesis of cytochrome c oxidase), enable subunits 1 and 2 to be incorporated into the holoprotein. This gene is the human homolog to the yeast SCO1 gene.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SCO1

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: PGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein SCO1 homolog, mitochondrial

Protein Size: 301

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56593_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56593_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6341
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×