SCP2 Antibody - N-terminal region : FITC

SCP2 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56537_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SCP2 protein is thought to be an intracellular lipid transfer protein. SCP2 is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SCP2

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: SSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Non-specific lipid-transfer protein Ensembl ENSP00000360564

Protein Size: 503

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56537_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56537_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6342
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×