Scyl3 Antibody - middle region : Biotin

Scyl3 Antibody - middle region : Biotin
Artikelnummer
AVIARP57775_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Scyl3 may play a role in regulating cell adhesion/migration complexes in migrating cells.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: NGLSDVKNTSEDNGSFPAGSNKPEEWPDWSEPEEPEQQPASIHRWPREPC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein-associating with the carboxyl-terminal domain of ezrin

Protein Size: 735

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57775_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57775_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 240880
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×