SCYL3 Antibody - N-terminal region : Biotin

SCYL3 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57774_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: SCYL3 may play a role in regulating cell adhesion/migration complexes in migrating cells.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SCYL3

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 83kDa

Peptide Sequence: Synthetic peptide located within the following region: MGSENSALKSYTLREPPFTLPSGLAVYPAVLQDGKFASVFVYKRENEDKV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein-associating with the carboxyl-terminal domain of ezrin

Protein Size: 742

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57774_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57774_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57147
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×