SDCBP2 Antibody - N-terminal region : FITC

SDCBP2 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55326_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SDCBP2 contains 2 PDZ (DHR) domains. The function of SDCBP2 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SDCBP2

Key Reference: Deloukas,P., (2001) Nature 414 (6866), 865-871

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: VAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Syntenin-2

Protein Size: 207

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55326_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55326_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 27111
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×