SDCBP2 Antibody - N-terminal region : HRP

SDCBP2 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55326_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SDCBP2 contains 2 PDZ (DHR) domains. The function of SDCBP2 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SDCBP2

Key Reference: Deloukas,P., (2001) Nature 414 (6866), 865-871

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: VAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Syntenin-2

Protein Size: 207

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55326_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55326_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 27111
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×