SDR39U1 Antibody - middle region : FITC

SDR39U1 Antibody - middle region : FITC
Artikelnummer
AVIARP57368_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) superfamily, which includes both classical and extended types. The encoded protein represents an extended type, with similarity to epimerases. Alternatively spliced transcript variants that encode different protein isoforms have been described.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human SDR39U1

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: KAWVLVTGVAYYQPSLTAEYDEDSPGGDFDFFSNLVTKWEAAARLPGDST

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Epimerase family protein SDR39U1

Protein Size: 293

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57368_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57368_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 56948
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×