SEMA3D Antibody - middle region : Biotin

SEMA3D Antibody - middle region : Biotin
Artikelnummer
AVIARP55526_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: SEMA3D induces the collapse and paralysis of neuronal growth cones. SEMA3D could potentially act as repulsive cues toward specific neuronal populations.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SEMA3D

Molecular Weight: 90kDa

Peptide Sequence: Synthetic peptide located within the following region: LECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Semaphorin-3D

Protein Size: 777

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55526_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55526_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 223117
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×