SEMA3D Antibody - middle region : HRP

SEMA3D Antibody - middle region : HRP
Artikelnummer
AVIARP55526_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SEMA3D induces the collapse and paralysis of neuronal growth cones. SEMA3D could potentially act as repulsive cues toward specific neuronal populations.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SEMA3D

Molecular Weight: 90kDa

Peptide Sequence: Synthetic peptide located within the following region: LECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Semaphorin-3D

Protein Size: 777

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55526_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55526_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 223117
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×