SENP1 Antibody - middle region : FITC

SENP1 Antibody - middle region : FITC
Artikelnummer
AVIARP55082_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The covalent modification of proteins by the small ubiquitin-like protein SUMO is implicated in the regulation of nucleocytoplasmic transport, genomic stability, gene transcription, and other processes. Sumoylation is catalyzed on target lysine residues by a multienzyme process and is reversed by desumoylating enzymes such as SENP1.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SENP1

Key Reference: Ohbayashi,N., (2008) Biochem. Biophys. Res. Commun. 371 (4), 823-828

Molecular Weight: 73kDa

Peptide Sequence: Synthetic peptide located within the following region: PQQMNGSDCGMFACKYADCITKDRPINFTQQHMPYFRKRMVWEILHRKLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Sentrin-specific protease 1

Protein Size: 643

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55082_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55082_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 29843
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×