SENP2 Antibody - middle region : FITC

SENP2 Antibody - middle region : FITC
Artikelnummer
AVIARP57548_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SUMO1 (UBL1; MIM 601912) is a small ubiquitin-like protein that can be covalently conjugated to other proteins. SENP2 is one of a group of enzymes that process newly synthesized SUMO1 into the conjugatable form and catalyze the deconjugation of SUMO1-containing species.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SENP2

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: RICEILLQYLQDESKTKRNSDLNLLEWTHHSMKPHEIPQQLNGSDCGMFT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Sentrin-specific protease 2

Protein Size: 589

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57548_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57548_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 59343
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×