SEPT11 Antibody - N-terminal region : HRP

SEPT11 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57173_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SEPT11 belongs to the conserved septin family of filament-forming cytoskeletal GTPases that are involved in a variety of cellular functions including cytokinesis and vesicle trafficking.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SEPT11(septin 11)

Key Reference: Xin,X., (2007) J. Histochem. Cytochem. 55 (11), 1089-1094

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGET

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Septin-11

Protein Size: 429

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57173_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57173_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 55752
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×