SEPT2 Antibody - N-terminal region : FITC

SEPT2 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56660_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SEPT2 is required for normal progress through mitosis. SEPT2 is involved in cytokinesis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SEPT2

Key Reference: Spiliotis,E.T., (2008) J. Cell Biol. 180 (2), 295-303

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Septin-2

Protein Size: 361

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56660_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56660_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4735
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×