SERINC2 Antibody - N-terminal region : Biotin

SERINC2 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55789_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SERINC2

Key Reference: Player,A., (2003) Int. J. Cancer 107 (2), 238-243

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: VCEEGAGIPTVLQGHIDCGSLLGYRAVYRMCFATAAFFFFFTLLMLCVSS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine incorporator 2

Protein Size: 455

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55789_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55789_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 347735
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×