SERPINA5 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: SERPINA5 belongs to the serpin family. It Inhibits activated protein C as well as plasminogen activators.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SERPINA5

Key Reference: Li,W., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (12), 4661-4666

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: LPSEGKMQQVENGLSEKTLRKWLKMFKKRQLELYLPKFSIEGSYQLEKVL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Plasma serine protease inhibitor

Protein Size: 406

Purification: Affinity Purified

• Artikelnummer: AVIARP53555_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53555_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5104
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin