SERPINA5 Antibody - C-terminal region : FITC

SERPINA5 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP53556_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SERPINA5 belongs to the serpin family. It Inhibits activated protein C as well as plasminogen activators.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SERPINA5

Key Reference: Li,W., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (12), 4661-4666

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: VFTSHADLSGISNHSNIQVSEMVHKAVVEVDESGTRAAAATGTIFTFRSA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Plasma serine protease inhibitor

Protein Size: 406

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53556_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53556_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5104
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×