SERPINB2 Antibody - middle region : Biotin

SERPINB2 Antibody - middle region : Biotin
Artikelnummer
AVIARP56375_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: SERPINB2 inhibits urokinase-type plasminogen activator. The monocyte derived PAI-2 is distinct from the endothelial cell-derived PAI-1.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SERPINB2

Key Reference: Croucher,D.R., (2007) Biochem. J. 408 (2), 203-210

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: GKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Plasminogen activator inhibitor 2

Protein Size: 415

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56375_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56375_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5055
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×