SERPINI1 Antibody - middle region : HRP

SERPINI1 Antibody - middle region : HRP
Artikelnummer
AVIARP56616_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of the serpin superfamily of serine proteinase inhibitors. The protein is primarily secreted by axons in the brain, and preferentially reacts with and inhibits tissue-type plasminogen activator. It is thought to play a role in t

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SERPINI1

Key Reference: Goedert,M., (2007) Neurology 69 (1), 79-83

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: ALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Neuroserpin

Protein Size: 410

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56616_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56616_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5274
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×