SERPINI2 Antibody - middle region : Biotin

SERPINI2 Antibody - middle region : Biotin
Artikelnummer
AVIARP56686_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a member of the serine protease inhibitor (serpin) superfamily made up of proteins which play central roles in the regulation of a wide variety of physiological processes, including coagulation, fibrinolysis, development, malignancy and inflammation. The gene product may have a role in a growth-control, possibly growth-suppressing pathway and, when impaired, may be involved in pancreatic carcinogenesis. The protein is a member of the plasminogen activator inhibitor-1 family, a subset of the serpin superfamily whose members act as tissue-specific tPA inhibitors. Two alternatively spliced transcript variants encoding distinct protein isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SERPINI2

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: SSEVYVSQVTQKVFFEINEDGSEAATSTGIHIPVIMSLAQSQFIANHPFL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serpin I2

Protein Size: 405

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56686_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56686_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5276
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×