SETD4 Antibody - C-terminal region : HRP

SETD4 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP58045_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SETD4

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: NAVLQKVSHMKDEKEALINQLTLVESLWTEELKILRASAETLHSLQTAFT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: SET domain-containing protein 4

Protein Size: 440

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP58045_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58045_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54093
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×