SFN Antibody - middle region : HRP

SFN Antibody - middle region : HRP
Artikelnummer
AVIARP54792_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SFN is an adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathway. SFN binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. When bound to KRT17, SFN regulates protein synthesis and epithelial cell growth by stimulating Akt/mTOR pathway.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SFN

Key Reference: Yang,W., (2008) Cell Cycle 7 (5), 670-682

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: FHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: 14-3-3 protein sigma

Protein Size: 248

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54792_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54792_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 2810
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×