SFRS12IP1 Antibody - N-terminal region : FITC

SFRS12IP1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55718_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SFRS12IP1 is a possible splicing regulator involved in the control of cellular survival.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SFRS12IP1

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: GYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDSDEENEELNKLQALQEK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein SREK1IP1

Protein Size: 155

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55718_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55718_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 285672
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×