SFRS7 Antibody - N-terminal region : HRP

SFRS7 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56231_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SFRS7 is required for pre-mRNA splicing. SFRS7 can also modulate alternative splicing in vitro.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SFRS7

Key Reference: Swartz,J.E., (2007) J. Biol. Chem. 282 (27), 19844-19853

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Serine/arginine-rich splicing factor 7

Protein Size: 238

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56231_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56231_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6432
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×