Description of Target: Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.
Key Reference: cDNA and deduced amino acid sequence of human pulmonary surfactant-associated proteolipid SPL(Phe). Glasser S.W., Korfhagen T.R., Weaver T., Pilot-Matias T., Fox J.L., Whitsett J.A. Proc. Natl. Acad. Sci. U.S.A. 84:4007-4011(1987).
Molecular Weight: 24.7 kDa.
Product Format: Liquid or Lyophilized powder.
Protein Name: Pulmonary surfactant-associated protein B.
Protein Sequence: FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM.
Protein Size: 201-279 aa.
Purity: Greater than 90% as determined by SDS-PAGE.
Source: in vitro E. Coli expression system.
Tag: N-terminal 6xHis-SUMO-tagged