SFXN4 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: SFXN4 is a multi-pass membrane protein. It belongs to the sideroflexin family. SFXN4 is a potential iron transporter.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SFXN4

Key Reference: Deloukas,P., (2004) Nature 429 (6990), 375-381

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: SCTVLAMGLMVPFSFSIFPQIGQIQYCSLEEKIQSPTEETEIFYHRGV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Sideroflexin-4

Protein Size: 337

Purification: Affinity Purified

• Artikelnummer: AVIARP53531_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53531_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Pig (Porcine), Rabbit
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 119559
• Wirt: Rabbit
• Konjugat: Conjugated, HRP