SGK1 Antibody - N-terminal region : Biotin

SGK1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56652_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a serine/threonine protein kinase that plays an important role in cellular stress response. This kinase activates certain potassium, sodium, and chloride channels, suggesting an involvement in the regulation of processes such as cell sur

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SGK1

Key Reference: Pew,T., (2008) Endocrinology 149 (5), 2637-2645

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: ANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein kinase Sgk1

Protein Size: 431

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56652_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56652_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 6446
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×