SGMS1 Antibody - middle region : Biotin

SGMS1 Antibody - middle region : Biotin
Artikelnummer
AVIARP55475_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: SGMS1 is predicted to be a five-pass transmembrane protein. This gene may be predominately expressed in brain.The protein encoded by this gene is predicted to be a five-pass transmembrane protein. This gene may be predominately expressed in brain. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SGMS1

Key Reference: Ding,T., (2008) J. Lipid Res. 49 (2), 376-385

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: SCFVLTTVMISVVHERVPPKEVQPPLPDTFFDHFNRVQWAFSICEINGMI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphatidylcholine:ceramide cholinephosphotransferase 1

Protein Size: 413

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55475_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55475_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 259230
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×