SH3BP2 Antibody - middle region : Biotin

SH3BP2 Antibody - middle region : Biotin
Artikelnummer
AVIARP56546_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: SH3BP2 has an N-terminal pleckstrin homology (PH) domain, an SH3-binding proline-rich region, and a C-terminal SH2 domain. The protein binds to the SH3 domains of several proteins including the ABL1 and SYK protein tyrosine kinases, and functions as a cytoplasmic adaptor protein to positively regulate transcriptional activity in T, natural killer (NK), and basophilic cells. Mutations in this gene result in cherubism.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SH3BP2

Key Reference: Idowu,B.D., (2008) Br J Oral Maxillofac Surg 46 (3), 229-230

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: RQPSQADTGGDDSDEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEPQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: SH3 domain-binding protein 2

Protein Size: 561

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56546_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56546_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 6452
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×