SH3BP2 Antibody - middle region : HRP

SH3BP2 Antibody - middle region : HRP
Artikelnummer
AVIARP56546_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SH3BP2 has an N-terminal pleckstrin homology (PH) domain, an SH3-binding proline-rich region, and a C-terminal SH2 domain. The protein binds to the SH3 domains of several proteins including the ABL1 and SYK protein tyrosine kinases, and functions as a cytoplasmic adaptor protein to positively regulate transcriptional activity in T, natural killer (NK), and basophilic cells. Mutations in this gene result in cherubism.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SH3BP2

Key Reference: Idowu,B.D., (2008) Br J Oral Maxillofac Surg 46 (3), 229-230

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: RQPSQADTGGDDSDEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEPQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: SH3 domain-binding protein 2

Protein Size: 561

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56546_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56546_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 6452
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×