SH3BP4 Antibody - N-terminal region : Biotin

SH3BP4 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55076_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a protein with 3 Asn-Pro-Phe (NPF) motifs, an SH3 domain, a PXXP motif, a bipartite nuclear targeting signal, and a tyrosine phosphorylation site. This protein is involved in cargo-specific control of clathrin-mediated endocytosis, specifically controlling the internalization of a specific protein receptor.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SH3BP4

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: PSSYVQPLNYRNSTLSDSGMIDNLPDSPDEVAKELELLGGWTDDKKVPGR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: SH3 domain-binding protein 4

Protein Size: 552

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55076_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55076_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23677
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×