SH3GL1 Antibody - N-terminal region : Biotin

SH3GL1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56547_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: SH3GL1 is implicated in endocytosis. It may recruit other proteins to membranes with high curvature.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SH3GL1

Key Reference: Ralser,M., (2005) Hum. Mol. Genet. 14 (19), 2893-2909

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: LNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGES

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Endophilin-A2

Protein Size: 368

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56547_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56547_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6455
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×