SH3GL2 Antibody - middle region : HRP

SH3GL2 Antibody - middle region : HRP
Artikelnummer
AVIARP56550_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SH3GL2 is implicated in synaptic vesicle endocytosis. SH3GL2 may recruit other proteins to membranes with high curvature.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SH3GL2

Key Reference: Sinha,S., (2008) Ann. Surg. Oncol. 15 (4), 1070-1080

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: PRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Endophilin-A1

Protein Size: 352

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56550_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56550_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6456
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×