SH3GL2 Antibody - N-terminal region : FITC

SH3GL2 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56549_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SH3GL2 is implicated in synaptic vesicle endocytosis. SH3GL2 may recruit other proteins to membranes with high curvature.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SH3GL2

Key Reference: Sinha,S., (2008) Ann. Surg. Oncol. 15 (4), 1070-1080

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: INTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Endophilin-A1

Protein Size: 352

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56549_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56549_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6456
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×