Sh3gl3 Antibody - middle region : Biotin

Sh3gl3 Antibody - middle region : Biotin
Artikelnummer
AVIARP56551_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Sh3gl3 is implicated in endocytosis. It may recruit other proteins to membranes with high curvature.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: IDPLQLLQDKDLKEIGHHLRKLEGRRLDYDYKKRRVGKIPEEEIRQAVEK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Endophilin-A3

Protein Size: 347

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56551_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56551_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 20408
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×