Sh3kbp1 Antibody - C-terminal region : FITC

Sh3kbp1 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP54454_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Sh3kbp1 binds apoptosis-linked gene 2 (ALG-2) interacting protein 1; involved in regulation of apoptosis in astrocytes.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Sh3kbp1

Molecular Weight: 73kDa

Peptide Sequence: Synthetic peptide located within the following region: QSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGIDVSKKTSRTVTISQVS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: SH3-domain kinase binding protein 1 EMBL AAH70877.1

Protein Size: 665

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54454_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54454_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 84357
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×