SHC3 Antibody - middle region : FITC

SHC3 Antibody - middle region : FITC
Artikelnummer
AVIARP56958_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SHC3 is a signaling adapter that couples activated growth factor receptors to signaling pathway in neurons. SHC3 is involved in the signal transduction pathways of neurotrophin-activated Trk receptors in cortical neurons.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SHC3

Key Reference: Villanacci,V., (2008) Neurogastroenterol. Motil. 20 (3), 206-212

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: RLKPRPHAPDTAQFAGKEQTYYQGRHLGDTFGEDWQQTPLRQGSSDIYST

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: SHC-transforming protein 3

Protein Size: 594

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56958_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56958_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 53358
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×