Shc3 Antibody - N-terminal region : HRP

Shc3 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56957_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Shc3 is a signaling adapter that couples activated growth factor receptors to signaling pathway in neurons. It is involved in the signal transduction pathways of neurotrophin-activated Trk receptors in cortical neurons.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: PSKMLSSILGKSNLQFAGMSISLTISTASLNLRTPDSKQIIANHHMRSIS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: SHC-transforming protein 3

Protein Size: 474

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56957_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56957_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 20418
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×