Shq1 Antibody - N-terminal region : HRP

Shq1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57120_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Shq1 is required for the quantitative accumulation of H/ACA ribonucleoproteins (RNPs), including telomerase, probably through the stabilization of DKC1, from the time of its synthesis until its association with NOP10, NHP2, and NAF1 at the nascent H/ACA RNA.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Shq1

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: PYFLRLTLPGRIVENGSEQGTYDADKGIFTIRLPKETPGQHFEGLNMLTA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein SHQ1 homolog

Protein Size: 458

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57120_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57120_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 72171
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×