SIK3 Antibody - C-terminal region : FITC

SIK3 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP53785_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of KIAA0999 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SIK3

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: SDAVLSQSSLMGSQQFQDGENEECGASLGGHEHPDLSDGSQHLNSSCYPS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein kinase SIK3

Protein Size: 598

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53785_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53785_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23387
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×