Ska1 Antibody - middle region : Biotin

Ska1 Antibody - middle region : Biotin
Artikelnummer
AVIARP55460_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Ska1 is a Component of the SKA1 complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. It is required for timely anaphase onset during mitosis, when chromosomes undergo bipolar attachment on spindle microtubules leading to silencing of the spindle checkpoint. The SKA1 complex is a direct component of the kinetochore-microtubule interface and directly associates with microtubules as oligomeric assemblies. The complex facilitates the processive movement of microspheres along a microtubule in a depolymerization-coupled manner. In the complex, it mediates the interaction with microtubules.

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: LLNKFELEIQYQEQTNSSLKELCESLREECEDVEHLKEHVPPHLPQVTAT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Spindle and kinetochore-associated protein 1

Protein Size: 254

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55460_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55460_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 66468
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×