SKIL Antibody - middle region : Biotin

SKIL Antibody - middle region : Biotin
Artikelnummer
AVIARP58074_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: SKIL belongs to the SKI family and may have regulatory role in cell division or differentiation in response to extracellular signals.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SKIL

Molecular Weight: 70kDa

Peptide Sequence: Synthetic peptide located within the following region: LQNEHAQRMEEFYVEQKDLEKKLEQIMKQKCTCDSNLEKDKEAEYAGQLA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ski-like protein

Protein Size: 638

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58074_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58074_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6498
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×