SLC18A1 Antibody - N-terminal region : HRP

SLC18A1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP58078_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The vesicular monoamine transporter acts to accumulate cytosolic monoamines into vesicles, using the proton gradient maintained across the vesicular membrane. Its proper function is essential to the correct activity of the monoaminergic systems that have been implicated in several human neuropsychiatric disorders. The transporter is a site of action of important drugs, including reserpine and tetrabenazine.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SLC18A1

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: FKEVNSSLHLGHAGSSPHALASPAFSTIFSFFNNNTVAVEESVPSGIAWM

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Chromaffin granule amine transporter Ensembl ENSP00000428001

Protein Size: 385

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58078_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58078_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6570
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×