Slc25a31 Antibody - middle region : FITC

Slc25a31 Antibody - middle region : FITC
Artikelnummer
AVIARP53806_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Slc25a31 catalyzes the exchange of ADP and ATP across the mitochondrial inner membrane. It may serve to mediate energy generating and energy consuming processes in the distal flagellum, possibly as a nucleotide shuttle between flagellar glycolysis, protein phosphorylation and mechanisms of motility.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: ARTRLGVDIGKGPEQRQFTGLGDCIMKIAKSDGLIGLYQGFGVSVQGIIV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: ADP/ATP translocase 4

Protein Size: 320

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53806_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53806_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 73333
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×