Slc25a31 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Slc25a31 catalyzes the exchange of ADP and ATP across the mitochondrial inner membrane. It may serve to mediate energy generating and energy consuming processes in the distal flagellum, possibly as a nucleotide shuttle between flagellar glycolysis, protein phosphorylation and mechanisms of motility.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: ARTRLGVDIGKGPEQRQFTGLGDCIMKIAKSDGLIGLYQGFGVSVQGIIV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: ADP/ATP translocase 4

Protein Size: 320

Purification: Affinity Purified

• Artikelnummer: AVIARP53806_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53806_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 73333
• Wirt: Rabbit
• Konjugat: Conjugated, HRP