SLC25A31 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Mitochondrial ADP/ATP carriers, such as SLC25A31, are nuclear-coded mitochondrial proteins that catalyze the exchange of ATP generated in mitochondria by ATP synthase (see MIM 108729) against ADP produced in cytosol by most energy-consuming reactions.Mitochondrial ADP/ATP carriers, such as SLC25A31, are nuclear-coded mitochondrial proteins that catalyze the exchange of ATP generated in mitochondria by ATP synthase (see MIM 108729) against ADP produced in cytosol by most energy-consuming reactions (Dolce et al., 2005 [PubMed 15670820]).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC25A31

Key Reference: Kim,Y.H., (2007) Dev. Biol. 302 (2), 463-476

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: LAGGVAAAVSKTAVAPIERVKLLLQVQASSKQISPEARYKGMVDCLVRIP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: ADP/ATP translocase 4

Protein Size: 315

Purification: Affinity Purified

• Artikelnummer: AVIARP53805_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53805_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 83447
• Wirt: Rabbit
• Konjugat: Conjugated, FITC