Uniprot: P02730
Gene Name: SLC4A1
Immunogen: Recombinant human SLC4A1
Purity: ≥85%
Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide
Identity-Mouse (%): 69%
Core Sequence: MMEENLEQEEYEDPDIPESQMEEPAAHDTEATATDYHTTSHPGTHKVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSSPAKPDSSFYKGLDLNGGPDD
Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 69%, Rat - 69%, Pig - 63%, Cynomolgus monkey - 89%
Alternative gene names: AE1；DI；EPB3
Alternative protein names: Band 3 anion transport protein; Anion exchange protein 1; AE 1; Anion exchanger 1; Solute carrier family 4 member 1; CD antigen CD233
Protein name: Solute carrier family 4 member 1 (Diego blood group)
CD Antigen: CD233
Product panel: CD Antigen
Clone No.: K16256_13B3
Antigen Species: Human
Target Name: SLC4A1
IHC Verification: succeed
IHC Dilution: 1:200
WB Verification: Fail (K-562,MOLT-4,HL-60,A549)
WB Dilution: N/A
IP Verification: -
IP Dilution: N/A
IF Verification: -
IF Dilution: N/A
Sandwich ELISA Verification: -
Sandwich ELISA Dilution: N/A
Antigen ID: PP-4225
Cross reactivity: Not tested
Deutsch
English
